PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG142500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 25037.4 Da    PI: 8.2556
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG142500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.14.1e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtfskRr+g+ KKA E+ vLCdaev v+ifss gkly+y+s
  Pavir.2NG142500.1.p  9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDAEVGVVIFSSGGKLYDYCS 59
                         79***********************************************96 PP

2K-box61.43.7e-2171160190
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL   eL  +e++L+++ ++ R+k +++++++ ++ ++ e+e++  
  Pavir.2NG142500.1.p  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRHLKGEDLNSLPPTELIAIEEALQNGQTNQRDKLMDHWRMHKRNGKMLEDEHKML 160
                          89999999***********************************************************99999999999988888887654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.043161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-33295IPR002100Transcription factor, MADS-box
CDDcd002652.88E-43280No hitNo description
PRINTSPR004047.1E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014865.1E-1482164IPR002487Transcription factor, K-box
PROSITE profilePS5129711.91184170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD AEVGVVIFSS GGKLYDYCSP  60
RTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRHLKG EDLNSLPPTE  120
LIAIEEALQN GQTNQRDKLM DHWRMHKRNG KMLEDEHKML SFRMAYQHQQ EAELSGGMRE  180
LEIGYHQVQH DRDFTSQMPF TFRVQPSHPN LQEDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19171169Myocyte-specific enhancer factor 2B
1tqe_Q1e-19171169Myocyte-specific enhancer factor 2B
1tqe_R1e-19171169Myocyte-specific enhancer factor 2B
1tqe_S1e-19171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.224780.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269300.0KJ726930.1 Zea mays clone pUT3475 MADS transcription factor (MADS29) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.11e-154PREDICTED: MADS-box transcription factor 4-like
SwissprotQ407031e-133MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLK3Z9J31e-154K3Z9J3_SETIT; Uncharacterized protein
STRINGSi023214m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-72MIKC_MADS family protein